Product Added to your Cart
x

-------- OR --------

$0.00
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL

Wallets

2 product(s) found for "Wallets"
Pretty in Pink
Luxury Badge Holder Wallet, with ID Card window, and double eyelet. Made of 100% Leather. Snap closure Handcuff design Includes 10' security chain. Designed for carrying police badges and department issued ID credentials for officers while on/off duty, there is no credit card compartment. Only a clear ID slot and a badge insert with suede protector flap This leather police badge holder is made for...
Details
Pretty in Pink
True Blue
Luxury Badge Holder Wallet, with ID Card window, and double eyelet. Made of 100% Leather. Snap closure Handcuff design Includes 10' security chain. Designed for carrying police badges and department issued ID credentials for officers while on/off duty, there is no credit card compartment. Only a clear ID slot and a badge insert with suede protector flap This leather police badge holder is made for...
Details
True Blue
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i